SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9X1V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9X1V6
Domain Number 1 Region: 113-234
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-33
Family cAMP-binding domain 0.00000189
Further Details:      
 
Domain Number 2 Region: 243-366
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.63e-29
Family cAMP-binding domain 0.00000252
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.44e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9X1V6
Sequence length 377
Comment (tr|A0A0Q9X1V6|A0A0Q9X1V6_DROWI) Uncharacterized protein, isoform B {ECO:0000313|EMBL:KRF99046.1} KW=Complete proteome; Reference proteome OX=7260 OS=Drosophila willistoni (Fruit fly). GN=Dwil_GK25343 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQ
VKLDASKQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDAANYVKKVVPKDYKTM
NALSKAIAKNVLFAHLDESERSDIFDAMFPVNHTAGENIIQQGDEGDNFYVIDVGEVDVF
VNSELVTTISEGGSFGELALIYGTPRAATVRAKSDVKLWGIDRDSYRRILMGSTIRKRKM
YEEFLSRVSILESLDKWERLTVADSLETCSFEDGETIVKQGAAGDDFYIILEGCAVVLQQ
RSEQGEEPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCAD
ILKRNITQYNSFVSLSV
Download sequence
Identical sequences A0A0Q9X1V6
XP_015033299.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]