SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0Q9XGR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0Q9XGR2
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-39
Family G proteins 0.0000245
Further Details:      
 
Domain Number 2 Region: 207-246
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000157
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0Q9XGR2
Sequence length 278
Comment (tr|A0A0Q9XGR2|A0A0Q9XGR2_DROMO) Uncharacterized protein, isoform C {ECO:0000313|EMBL:KRG06857.1} KW=Complete proteome; Reference proteome OX=7230 OS=Drosophila mojavensis (Fruit fly). GN=Dmoj_GI21615 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
MICGCNPVRMCICVFGLSNTVSYMRTMTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTE
SPFCSGNAYKTTTILLEGKRVKLQIWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSF
DGIDRWLKEVEEHAPGIPKVLVGNRLHLAYKRQVAAKTAETYASRNNMSCFEISPLCDFN
IRESFCELARMALHRNGMEHIWRSNKVLSLQELCCRTIVRRTSVYAIDSLHLPPSVKSTL
KSYAMTTSQCYNSLTQNSKSRNRCKTPTSHSRNSCAIA
Download sequence
Identical sequences A0A0Q9XGR2
XP_015016521.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]