SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R0AI37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0AI37
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily VC0467-like 1.96e-64
Family VC0467-like 0.0000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R0AI37
Sequence length 188
Comment (tr|A0A0R0AI37|A0A0R0AI37_STEMA) UPF0301 protein ARC78_12630 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=40324 OS=maltophilia). GN=ARC78_12630 OC=Stenotrophomonas maltophilia group.
Sequence
MSALSSPLANHLLVALPSLLDPHFARSVSLICQHDENGAMGVMVNQPSEYTLGEVLMQMD
IVSDDEALCAQPVLSGGPVHTERGFVIHDDARSWDSSLTVAEGLYLTTSRDILEAMARGE
GPRHALVTLGCAGWGAGQLEQELAQNSWLTVPADAGLLFDTPMDQRWQLSAARIGVDLFR
LAGYSGHA
Download sequence
Identical sequences A0A0R0AI37

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]