SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R0IE49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0IE49
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-19
Family Capz beta-1 subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R0IE49
Sequence length 114
Comment (tr|A0A0R0IE49|A0A0R0IE49_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:KRH37572.1, ECO:0000313|EnsemblPlants:KRH37572} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_09G074800 OC=Phaseoleae; Glycine; Soja.
Sequence
MWEDDNEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEENTNHQLTSTVM
LTLTTNNESSRTFSLSGSIRRQMSMKLSVADGHLCNMGRMIEEMESKLRNSLDQ
Download sequence
Identical sequences A0A0R0IE49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]