SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R0LUH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R0LUH5
Domain Number 1 Region: 103-148
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000034
Family Skp1 dimerisation domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R0LUH5
Sequence length 151
Comment (tr|A0A0R0LUH5|A0A0R0LUH5_9MICR) Uncharacterized protein {ECO:0000313|EMBL:KRH93030.1} KW=Complete proteome; Reference proteome OX=146866 OS=Pseudoloma neurophilia. GN=M153_17280002284 OC=Eukaryota; Fungi; Microsporidia; Pseudoloma.
Sequence
MLQPESLLIQSKDGHQYKLSNNLISRSVLLSQLIEYPVCSSVDNSSSVDDFLPIPFNLEI
IKLAESFSSIDTLTKIENIGLYDTSLYKPMNIKHVFIPDVLLTFFDNLTIEQLTELINLS
NYLNYNLLLECLCNKLAKILNGTAAEEVVWT
Download sequence
Identical sequences A0A0R0LUH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]