SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R1LA77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0R1LA77
Domain Number - Region: 41-106
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.00157
Family Chemotaxis phosphatase CheZ 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R1LA77
Sequence length 114
Comment (tr|A0A0R1LA77|A0A0R1LA77_LACCU) Uncharacterized protein {ECO:0000313|EMBL:KRK92224.1} KW=Complete proteome OX=1293592 OS=Lactobacillus curvatus JCM 1096 = DSM 20019. GN=FC08_GL000908 OC=Lactobacillus.
Sequence
MKTRYKILIGVGVTAAVGATTAFVGSKAVIDKVSRYRKRLAVKSFVKDKLHGNQKALELV
DQLSDADVNNLLTAADRLTQLKDKLGEHADNLPDMMDDLRQTLMAYATKVKEKL
Download sequence
Identical sequences A0A0R1LA77 A0A1B2A548 G6CEH7
WP_004270262.1.302 WP_004270262.1.48807 WP_004270262.1.72498 WP_004270262.1.73773 WP_004270262.1.82145 WP_004270262.1.85325 WP_004270262.1.93478 WP_004270262.1.9365 WP_004270262.1.97063 WP_004270262.1.98391 WP_004270262.1.9963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]