SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R1U3N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0R1U3N0
Domain Number - Region: 20-86
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 0.00209
Family MAST3 pre-PK domain-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R1U3N0
Sequence length 124
Comment (tr|A0A0R1U3N0|A0A0R1U3N0_9LACO) Uncharacterized protein {ECO:0000313|EMBL:KRL84347.1} KW=Complete proteome OX=1423740 OS=Lactobacillus equi DSM 15833 = JCM 10991. GN=FC36_GL000270 OC=Lactobacillus.
Sequence
MEKDTREYKIVYKDYDEYFEQKVEKLYRLLGDDVRDDVKELLDEQTRYMHHLMYKSIEQQ
VRIDNLLEVNQKLHDCLKEKNEESEKFANKYDELEKDNKNFHKEIHSFINKYLNDIDNDD
YFEL
Download sequence
Identical sequences A0A0R1U3N0 V7HWE0
WP_023859279.1.19813 WP_023859279.1.77045 WP_023859279.1.96827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]