SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R2ITG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R2ITG0
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily YdhG-like 0.0000000000157
Family YdhG-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R2ITG0
Sequence length 131
Comment (tr|A0A0R2ITG0|A0A0R2ITG0_CARML) Uncharacterized protein {ECO:0000313|EMBL:KRN68271.1} KW=Complete proteome OX=1449341 OS=Carnobacterium maltaromaticum DSM 20342. GN=IV70_GL001659 OC=Carnobacterium.
Sequence
MTMTPFESSEVKAVFNQYSPQCKEALLTIRQLIIDTSAELTPHEKLVENLKWNQPTYTAK
AGTPIRIGIFEETKIALFFHCQTTLIEQFRELFTDTLVFSKNRAIVMDPTKPLPINDLKL
CIQMGLTYHSS
Download sequence
Identical sequences A0A0R2ITG0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]