SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R2NSI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R2NSI9
Domain Number 1 Region: 74-182
Classification Level Classification E-value
Superfamily YdhG-like 3.14e-21
Family YdhG-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R2NSI9
Sequence length 186
Comment (tr|A0A0R2NSI9|A0A0R2NSI9_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KRO26989.1} KW=Complete proteome OX=1655568 OS=Actinobacteria bacterium BACL2 MAG-120802-bin41. GN=ABR60_00975 OC=Bacteria; Actinobacteria; ac1 cluster.
Sequence
MAVKDKGSRQAHFPKIEAKYGQPMRYWFAVMKDISDLKYPQQISYLREEHGFSQAHANAL
VMYSRGSKSSKRFDDLEGYLKGQDEVKSKTIKKIFKVIKKKYPKLELVIAWNQPILKLGN
EYLFGASILKNHILIAPWNQKVLLAMKQDLEGYKVNKKTVQVPIDWKVDEKLLLKMIKLN
IQFLKK
Download sequence
Identical sequences A0A0R2NSI9 A0A0R2NZX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]