SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3MEF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3MEF0
Domain Number 1 Region: 7-163
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 1.01e-52
Family ChuX-like 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3MEF0
Sequence length 171
Comment (tr|A0A0R3MEF0|A0A0R3MEF0_9BRAD) Coproporphyrinogen III oxidase {ECO:0000313|EMBL:KRR18363.1} KW=Complete proteome; Reference proteome OX=722472 OS=Bradyrhizobium lablabi. GN=CQ14_29875 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MLSTDLADLRAYMAENPGAVIEDVARERKVTPRAVLEALPDTMVRFGPGGEFGAAMNDVA
QWGEVTLIVHTDDAIFEFTGSVPAGEVGRGYFNLMQPKGLHGHLRHERCAAIAFVERPFM
GKSSAFIAFINVDGGIMFKVFVGRDETRALRGDQLQRFHALGERIASARTA
Download sequence
Identical sequences A0A0R3MEF0
WP_057861599.1.96123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]