SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3N8Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3N8Q4
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.9e-32
Family NIPSNAP 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3N8Q4
Sequence length 106
Comment (tr|A0A0R3N8Q4|A0A0R3N8Q4_9BRAD) NIPSNAP family containing protein {ECO:0000313|EMBL:KRR26341.1} KW=Complete proteome; Reference proteome OX=722472 OS=Bradyrhizobium lablabi. GN=CQ14_02205 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MIYDHRTYNLVPLKMGKWLALYEECALPVQQKYLGNLIGFFQTEIGTLNQVVHLWGFADL
NDRARRRAEMAKDPAWHDFLRKNEELGALLHQESKIIVPVKFSPLQ
Download sequence
Identical sequences A0A0R3N8Q4
WP_057857011.1.96123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]