SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3NHP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3NHP0
Domain Number 1 Region: 81-118
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000144
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0029
Further Details:      
 
Domain Number 2 Region: 8-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R3NHP0
Sequence length 1461
Comment (tr|A0A0R3NHP0|A0A0R3NHP0_DROPS) Uncharacterized protein, isoform C {ECO:0000313|EMBL:KRT00585.1} KW=Complete proteome; Reference proteome OX=46245 OS=Drosophila pseudoobscura pseudoobscura (Fruit fly). GN=Dpse_GA27314 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTEKSLPRVPEGLRDLMKMYAKEVLRQKPENLYKFSADFFNLIVTEKSNRVMRKYEPIQT
YESMIKNRIQQQMPLSLVFHIIPENLTELIKQFIKAVLKESPDNIYIFAQEYFQKLSEVK
SIHTEYTKYTEYEGSLRDKEPFKSVAKVTCQCGRTITGDAAEVQNNDIISSTMIPLNDCT
SIAEAKKENQKIYDHNCLKAVIIIQRNFRRYKIQKKISSDKEKYDKEYLRAVFLIQRLIR
CYLAKKRFEKQKDSEKEKRRNDTHSTGDYIHAVIVIQRQYRRYLNKKIRQKNRFKNGSFG
LVTAAIIIQRAFRRMVDARRVKGNVPDVVDNREELNDIYSETCSYNSVSTAPLSTDSTTE
LKDFVNTNFEDVIQSTIKMQEEVDNNNPCLVLENEYAAVKKDENSTKVQKNDDLKINEIP
GLIELSDLTKISISEKVENSLCENGESDIITHPVSEQQNGLTLEDEDNATGKSNKENDAE
KEFDVLPDKDEQTIVIGSEISESGHRFSGEQDLEIPVSSALPKELDGLIEQSDLTKISIS
EKVDNSLCENGESDIITHPVSEQHNEPQKNFEDEDNATGKTNKDNGAEKEFDVLPDKEEQ
TIVIGSEISKSGHRFSGEQDVEIPVSSAPPKELDGVIELSELTKRSISEIVDNSLCENGE
SNIVTHPVSEQHNGPQKKLEDEDNASGKTNKDNGAEKEFDVLPDKDEQTIVIGSDISESK
HHFPDDPTSNTISNLTKRSVTGIDDNALSENGERPNGLQINFKDDDTSDVQCRPDKGSTV
LVSNQLFGTHNFNNDTIEIKNKKTTKLPIPKLKHKEIGSVQNSRFIPRPVAELQLKSFKS
PTDKGTWYEIYTDFEMNQSLAYADTGEVKNTREVPIQDLGKIASNMSTETEVTKVKRPIS
YFISFDKSDNGNRRYKVSNKSSFKTNKHGQIDKIIPLDDSSRSNLLGPHLIINEYREIED
PTADPDYQQQPGVAKLQTILELNESDIITDNRVTELELGLILPESSAVVGSAGDPGIFLL
SDAGASNHEVVSSQEQLNSSPIKEMTSITEKELVPNTQKEAIEELCIQKNSSILSDACNN
KEISDFVTNETIALEPFSEIKQENVSPKSSTSDEAVKQISNHLAFLNSNDEPLIRTIDSL
KEQASIEEGEIIVYNQMQLNETRESSAQSDSVVFGDVESEKFQIKDSNSEEESARAPLIR
HYTIAGDNPRGMFRSVTLEDARDDIEIDDEISENIRKKMLAFSLSETDSDCIDPRNINQE
NFEINTAMADILGTSTETESTIVSAATKIQAGARGFLTRRRMRRASAGTKSSTQETKASF
GNAAISESFERLIEEEAAKKIQAAYRMHTRKLKGHNRKMQGISLESNLAARRQKLQRGDA
LRNDSTPDEDNIPLTQKLPKSLRNKEKAGDGVKLKSSMELKWLTLRQNSMPVQIDCNILR
VIPKHKKKRIKSAEYKKMASK
Download sequence
Identical sequences A0A0R3NHP0
XP_015037616.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]