SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3P0V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3P0V1
Domain Number 1 Region: 103-194
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.4e-17
Family Fibrinogen C-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3P0V1
Sequence length 218
Comment (tr|A0A0R3P0V1|A0A0R3P0V1_DROPS) Uncharacterized protein {ECO:0000313|EMBL:KRT05093.1} KW=Complete proteome; Reference proteome OX=46245 OS=Drosophila pseudoobscura pseudoobscura (Fruit fly). GN=Dpse_GA32519 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLSTTFQLDVFMALIQLQISLQPNSLSHPAPLQRVPCSVTMDSCRSVRIFAADCTRHQAI
KPPRQHPLRPCRKDGVHSIGYRATQRCLLGGALTDTTYSRGRGFKNINGAGRRHAITKAQ
AQELCVHLEDLEGNTRYAQYDECRIERVRATSKSESYRTTRMGSYTGDAGDSMRDNKDRK
FTTYDRDNDQSLKQPFRLVCEWHCAQHGQKGSILEHMA
Download sequence
Identical sequences A0A0R3P0V1
XP_015037019.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]