SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3PFY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3PFY8
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000102
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 
Domain Number 2 Region: 45-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000234
Family Motor proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3PFY8
Sequence length 203
Comment (tr|A0A0R3PFY8|A0A0R3PFY8_ANGCS) Uncharacterized protein {ECO:0000313|WBParaSite:ACOC_0000313601-mRNA-1} KW=Complete proteome; Reference proteome OX=334426 OS=Angiostrongylus costaricensis (Nematode worm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MDARIRYKVPEGLRPLLEALARETLRSQPRDVIQFAQLFFDELQHHRKSNFIQKLTYNDD
RREDRCSSPLDEAATKIQAVFRGHCVRAHPEKFGVSKVISRTQSSEKVDSFNNKKDLKRH
SVGGYAINFDSPEDRAATKIQAEIRGFLARKHVEKMKKEDTEAATKIQAHIRGYLTRKHL
DEQGLLSPSRSRSPLQRSETDEK
Download sequence
Identical sequences A0A0R3PFY8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]