SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3PHP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3PHP6
Domain Number 1 Region: 17-100
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.91e-26
Family Calponin-homology domain, CH-domain 0.0000267
Further Details:      
 
Domain Number 2 Region: 170-228
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-16
Family EB1 dimerisation domain-like 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R3PHP6
Sequence length 235
Comment (tr|A0A0R3PHP6|A0A0R3PHP6_ANGCS) Uncharacterized protein {ECO:0000313|WBParaSite:ACOC_0000387301-mRNA-1} KW=Complete proteome; Reference proteome OX=334426 OS=Angiostrongylus costaricensis (Nematode worm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MKNIELSINAEVNRKSFTDFLFPGSISLKKVKWNSHLELDWLGNWKLVQTSWKSLGVEKI
VPVDKLIKGKFQDNFEFLQWFKKFFDANYDGHEYNPLDARGGEPLPVEQVGGKPSGVWRS
GRRRPTIRTGSIPASPPHQAFYRSRVGRLISYLSGRMVALARYIGWPPRLTRQVAEYEAE
MSIIEQERDFYFKKLRCIEVICGDNESIGTVAVPVILEILYETEEGFVAPDEEEQ
Download sequence
Identical sequences A0A0R3PHP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]