SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3PQJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3PQJ4
Domain Number 1 Region: 91-213
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.57e-34
Family Cap-Gly domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000501
Family Ubiquitin-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3PQJ4
Sequence length 227
Comment (tr|A0A0R3PQJ4|A0A0R3PQJ4_ANGCS) Uncharacterized protein {ECO:0000313|WBParaSite:ACOC_0000763001-mRNA-1} KW=Complete proteome; Reference proteome OX=334426 OS=Angiostrongylus costaricensis (Nematode worm). GN= OC=Strongylida; Metastrongyloidea; Angiostrongylidae; Angiostrongylus.
Sequence
MTEVYGLEISSNASEFPYEKKFPSLITLGELKKKLELVVGAAFESIHVELHDDQGKFVAS
LTDNSKSLKELGVRDGMRIHAIDISGENVELQDDSMVEKYTMSDDKYNSRKDTARAWKKK
LLDRKHTATMESNYKASEKIKVGDRCEVQLRNCMPRRGIVSFVGETEFREGLWVGVTYDE
PVGKNDGAVSGVRYFHCNDKHGGFVRPVDVVVGNFPPLGIEENMVEI
Download sequence
Identical sequences A0A0R3PQJ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]