SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3R716 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3R716
Domain Number 1 Region: 9-119
Classification Level Classification E-value
Superfamily SRP19 1.22e-32
Family SRP19 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3R716
Sequence length 146
Comment (tr|A0A0R3R716|A0A0R3R716_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:BTMF_0001581401-mRNA-1} KW=Complete proteome; Reference proteome OX=42155 OS=Brugia timori. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MAVQYKTKALSDECRWICIYPLYMNSRKTVAQGRRVSKNKAVDSPTAQEIFDILSNAGLK
VKLEKQKMHPLDPNRDANSQGRVRVQLHNDDGSLCDQKFPTRMSLMLYACEMVPKLKTRQ
FGGGATSQPSSGGGIGGGKTNKKKKR
Download sequence
Identical sequences A0A0K0JCC0 A0A0N4TXW5 A0A0R3R716
XP_001899803.1.25112 Bm3901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]