SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3RE43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3RE43
Domain Number 1 Region: 21-104
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000016
Family Snake venom toxins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3RE43
Sequence length 132
Comment (tr|A0A0R3RE43|A0A0R3RE43_BRUMA) Bm155 {ECO:0000313|WBParaSite:Bm155a} KW=Complete proteome; Reference proteome OX=6279 OS=Brugia malayi (Filarial nematode worm). GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MLKFIFYPIPLLAMLITTSDALKCFVGRQYFGALGNGGSFAEVLCPATSNFCVKRHFAIQ
YNEDVIEKTCDPNSQCYKVGNGCFYDANNAAEYCCCNSDSCNGATVTTTTFSLLIITAIC
FISTIFTHKLFE
Download sequence
Identical sequences A0A0R3R675 A0A0R3RE43
Bm155b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]