SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3RJK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3RJK9
Domain Number 1 Region: 93-167
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 9.68e-24
Family Skp1 dimerisation domain-like 0.0000939
Further Details:      
 
Domain Number 2 Region: 15-79
Classification Level Classification E-value
Superfamily POZ domain 0.000000000118
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3RJK9
Sequence length 169
Comment (tr|A0A0R3RJK9|A0A0R3RJK9_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:EEL_0000166801-mRNA-1} KW=Complete proteome; Reference proteome OX=1147741 OS=Elaeophora elaphi. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Elaeophora.
Sequence
MKSETDVTQSDKRSINLLSEDGEKLTVDMDIISQSKTIKNLLTDLLVDQVDESQPAFDLP
VQLPAKTIKKVLEWCTHQIHLTPEAEKSEEEKVWRQNFLALSDNNELFELVQAANYLDVS
DLLSSGCKVIANHIKGKTVEELRVFFNIENDFTPEEEARIRAENAWCEM
Download sequence
Identical sequences A0A0R3RJK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]