SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3RM52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3RM52
Domain Number 1 Region: 267-340
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000000068
Family Bactericidal permeability-increasing protein, BPI 0.01
Further Details:      
 
Domain Number 2 Region: 3-111
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.00000785
Family Bactericidal permeability-increasing protein, BPI 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0R3RM52
Sequence length 355
Comment (tr|A0A0R3RM52|A0A0R3RM52_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:EEL_0000256201-mRNA-1} KW=Complete proteome; Reference proteome OX=1147741 OS=Elaeophora elaphi. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Elaeophora.
Sequence
MILPIKLNSTVHATIHQISATGQLTVRRKLDGSPYVHIIGCYASSGFNDVFLEGDGLFED
IFNAYFRRNAAAQMRKQLPIRVCKMMQSIVEKRINAPLRGMSKVIPLNKLSNFAKRAINS
IKLADLPKHCRTTLCKRKIEHRQTISHLSASTGNFNTVPIDSQPVFTENDNTDVQEINDK
PSMHRFSLAHAEALQRVTSSPTSPTSANNGHRMDASASLDPCADCYSSNNISQYENDNKT
KILSNTVLNMKLIKISATPDYFQLGLRAAFGSQEMSETPFHPFPMHFPRFLNGNSKRMLD
VLISDYTINSLLYHMHKNDAIMFRVGPETPKLSGLLKTTCSDEDYDDFEDFVNFE
Download sequence
Identical sequences A0A0R3RM52

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]