SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3RZ17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3RZ17
Domain Number 1 Region: 104-227
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-30
Family cAMP-binding domain 0.0000096
Further Details:      
 
Domain Number 2 Region: 228-338
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-22
Family cAMP-binding domain 0.0000299
Further Details:      
 
Domain Number 3 Region: 12-58
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 4.97e-17
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3RZ17
Sequence length 354
Comment (tr|A0A0R3RZ17|A0A0R3RZ17_9BILA) Uncharacterized protein {ECO:0000313|WBParaSite:EEL_0000755301-mRNA-1} KW=Complete proteome; Reference proteome OX=1147741 OS=Elaeophora elaphi. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Elaeophora.
Sequence
MASGGSSEEAQLAQCQAYVQRHNIQQLVKEAIVSLCINKPENPILFLKEHFEKLYDQRSQ
ASDDDDTIDEPPKIQQGNRRRLAVSAEVPDENEAANYDKVVIPKDDETRRALEAAMCRNI
LFSHLEGDEQKAIFDAMFPVEKKKGETIIEQGEEGDNFYVIDSGEVDVFVNGEYALSIKE
GGSFGELALIYGTPRAATVVAKSDVVKCWAIDRITYRQILMGSTMRKRKLYDEFLSKVQI
LSDLDKWERANVADALERCDFEPGTRVVEQGHPGDEFFIIVEGQADVLQKRSDDAPFEII
ALLLDRPRAATVIAKTPLKCVKLDRARFERVMGPVREILKRDVSNYNSYVKLMT
Download sequence
Identical sequences A0A0R3RZ17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]