SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3SSE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3SSE6
Domain Number 1 Region: 92-215
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-32
Family cAMP-binding domain 0.00000982
Further Details:      
 
Domain Number 2 Region: 219-345
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-30
Family cAMP-binding domain 0.00019
Further Details:      
 
Domain Number 3 Region: 4-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000824
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3SSE6
Sequence length 370
Comment (tr|A0A0R3SSE6|A0A0R3SSE6_HYMDI) Uncharacterized protein {ECO:0000313|WBParaSite:HDID_0000821401-mRNA-1} KW=Complete proteome; Reference proteome OX=6216 OS=Hymenolepis diminuta (Rat tapeworm). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MSKKTVDVPPGLREILQEFTVAVLRQRPSNIINFAVDYFEMKKKEQNNNENAESDEEEEI
IRPPIKGKRRQGVAAESYDPEKDDDKYEKIVHEKTEEQRQRLLNATKSILLFKSLDDDQM
RDVIDAMFEKKVEVGEKVITLGEDGNYFYVIESGVFDIIVKVDGVEKKVGEYNNNGSFGE
LALMYNTPRAATIQATTPGIVWAMTRETFRSIVLKSAFKKRQMYEELLNQVGILQNLSAY
ERMSIADALHTQVFEPGTKIISQGEEGNEMYFVEDGEIRITVKQTGSDEEAEVNLIKKGG
FFGELALLTKHPRVASAYAVTRAKLAVLDVGSFERLLGPCLDIMQRNIDNYENQLKTVFG
SLHNVPELRH
Download sequence
Identical sequences A0A0R3SSE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]