SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3STF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3STF6
Domain Number 1 Region: 76-151
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.67e-17
Family Skp1 dimerisation domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000022
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3STF6
Sequence length 155
Comment (tr|A0A0R3STF6|A0A0R3STF6_HYMDI) Uncharacterized protein {ECO:0000313|WBParaSite:HDID_0000868601-mRNA-1} KW=Complete proteome; Reference proteome OX=6216 OS=Hymenolepis diminuta (Rat tapeworm). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MTIRILTKDGHIFDVDKKLLMKSKLMKDLIDDVGNEEAENNIPFPLIYVSSRALEKVILW
CQHYEEPIDESNSLYISVWDENFFNNMESEIMVDLLIAADYLDIPDLYEKCSQFCAKILT
SNSVEELRKIFGIECDLSFDELQRINDENEYFGRM
Download sequence
Identical sequences A0A0R3STF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]