SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3TGV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3TGV5
Domain Number 1 Region: 63-108
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.000000146
Family Blood coagulation inhibitor (disintegrin) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3TGV5
Sequence length 184
Comment (tr|A0A0R3TGV5|A0A0R3TGV5_HYMNN) Uncharacterized protein {ECO:0000313|WBParaSite:HNAJ_0000629601-mRNA-1} KW=Complete proteome; Reference proteome OX=102285 OS=Hymenolepis nana (Dwarf tapeworm) (Rodentolepis nana). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
LSSNGSFCGNRLTEEGEQCDCGFTREDCDDVCCYPKDSKEPCKLKKFANTGNASVKVRCS
PTAGECCTSSCQYRDSKHLCRSAGECHKASYCSGESAQCPSPENIPDGTPCMNHTRVCKG
GECLGSVCERIPGWTECSLSRGEDITPEMMCYVACRNIRNDTPCISTIQLETVSLPSMMN
KQST
Download sequence
Identical sequences A0A0R3TGV5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]