SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3VSI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3VSI6
Domain Number 1 Region: 245-365
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-32
Family cAMP-binding domain 0.00051
Further Details:      
 
Domain Number 2 Region: 114-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-30
Family cAMP-binding domain 0.0000612
Further Details:      
 
Domain Number 3 Region: 5-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000235
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0R3VSI6
Sequence length 380
Comment (tr|A0A0R3VSI6|A0A0R3VSI6_TAEAS) Uncharacterized protein {ECO:0000313|WBParaSite:TASK_0000012801-mRNA-1} KW=Complete proteome; Reference proteome OX=60517 OS=Taenia asiatica (Asian tapeworm). GN= OC=Cyclophyllidea; Taeniidae; Taenia.
Sequence
MANEQPDVPEGLIKLLQDFTIAILQNKPKNIPRFAVSYFTHLANNSESSMKSEPQQSVDT
DNSEVMDDDFAEKMIEMAAQRSSTRRDSVTAEPFNPDEEEEENEGGLGGRRSSFYEKTPE
QILRLKNVCRKIVLFSELDDAELIDVINAMFVKTAEPEEDIIKQHDDGDNFYVIDSGKFE
VKIEDGGSGMKVVKVYENEGFFGELALMYNSPRSATVTAVTEGILWALSRHSFRRHVLGH
AAKRRRAFIELLHSVPILQDLTPHQRMSLADNLQRKLVPKSEIIIREGDPGDALFFVMDG
VVGVKRQQGSTEKELGKIEKGGYFGELALLSNKPRAASVYAVTDVTLAVLGVESFERLLG
PCISLMKDQALDYEGQEDAI
Download sequence
Identical sequences A0A0R3VSI6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]