SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R3X7E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R3X7E3
Domain Number 1 Region: 241-362
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-32
Family cAMP-binding domain 0.00042
Further Details:      
 
Domain Number 2 Region: 111-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.37e-29
Family cAMP-binding domain 0.0000646
Further Details:      
 
Domain Number 3 Region: 5-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000157
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R3X7E3
Sequence length 377
Comment (tr|A0A0R3X7E3|A0A0R3X7E3_HYDTA) Uncharacterized protein {ECO:0000313|WBParaSite:TTAC_0000946801-mRNA-1} KW=Complete proteome; Reference proteome OX=6205 OS=Hydatigena taeniaeformis (Feline tapeworm) (Taenia taeniaeformis). GN= OC=Cyclophyllidea; Taeniidae; Hydatigera.
Sequence
MANEQPDVPEGLIKLLQDFTVSILQNKPKNIPRFAVSYFTRLANNSESSMRSELADTDNS
EVMDDEYAEKMREMAAQRSSTRRDSVTAEPFNPDEEEEENEGVPGGRRSSYYEKTPEQIA
RLKNVCRKIVLFSELDEAELIDVINAMFLKTAEPEEDIIKQHDDGDNFYVIDSGKFEVKI
EDRISGAKVVKVYEDEGFFGELALMYNSPRSATVTAVTEGILWALSRQSFRRHVLAHAAK
RRRAFIELLHSVPILQDLTPHQRMSLADNLQRKLVPKSETIIREGDPGDALFFVMDGVVS
VKRRQGSSEKELGKIEKGGYFGELALLSNKPRAASVYAVTDVTLAVLGVESFERLLGPCI
SLMKNQALDYEGQEDAI
Download sequence
Identical sequences A0A0R3X7E3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]