SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4FRJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0R4FRJ5
Domain Number - Region: 3-45
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0497
Family EB1 dimerisation domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R4FRJ5
Sequence length 46
Comment (tr|A0A0R4FRJ5|A0A0R4FRJ5_XENNE) Uncharacterized protein {ECO:0000313|EMBL:CEK25253.1} KW=Complete proteome OX=1437823 OS=Xenorhabdus nematophila AN6/1. GN=XNC2_4266 OC=Morganellaceae; Xenorhabdus.
Sequence
MNEYLNKSRHYYYDNKLQNQLTLSIEIKKQKYKKFECVNKIIYSQK
Download sequence
Identical sequences A0A0A8NS55 A0A0R4FRJ5 D3VEX8 N1NRB6
gi|300725171|ref|YP_003714499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]