SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0R4J337 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0R4J337
Domain Number 1 Region: 29-181
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 2.58e-55
Family Pollen allergen PHL P 1 N-terminal domain 0.0087
Further Details:      
 
Domain Number 2 Region: 160-251
Classification Level Classification E-value
Superfamily PHL pollen allergen 1.16e-34
Family PHL pollen allergen 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0R4J337
Sequence length 256
Comment (tr|A0A0R4J337|A0A0R4J337_SOYBN) Uncharacterized protein {ECO:0000313|EMBL:KRH61002.1, ECO:0000313|EnsemblPlants:KRH61002} KW=Complete proteome; Reference proteome OX=3847 OS=Glycine max (Soybean) (Glycine hispida). GN=GLYMA_04G021600 OC=Phaseoleae; Glycine; Soja.
Sequence
MAKVMFGLVCSFLVLCCFTINTSAFSPSGWTNAHATFYGGSDASGTMGGACGYGNLYSTG
YGTDTAALSTAIFNDGASCGECYKIICDYQTDPRWCLKGASVTITATNFCPPNFALPNNN
GGWCNPPLKHFDMAQPAWEKIGIYRGGIVPVLFQRVPCVKKGGIRFSVNGRDYFELVLIS
NVGGAGSIQSVSIKGSKTGWMTMSRNWGANWQSNAYLNGQSLSFRVTTTDGVTRFFQDVV
PSNWAFGQTFPTSVQF
Download sequence
Identical sequences A0A0R4J337
Glyma04g02380.1|PACid:16254588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]