SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S1UX15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S1UX15
Domain Number 1 Region: 79-200
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.31e-41
Family PH0987 C-terminal domain-like 0.0000577
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.000000000405
Family PH0987 N-terminal domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S1UX15
Sequence length 204
Comment (tr|A0A0S1UX15|A0A0S1UX15_9ACTN) Allophanate hydrolase {ECO:0000313|EMBL:ALM43302.1} KW=Complete proteome OX=206662 OS=Streptomyces sp. FR-008. GN=SFR_6687 OC=Streptomyces.
Sequence
MRFLPCADQGLLVDTGSLDEALALYRALEKSPPPGVEDLVPAARTVLLRLAPGADPARVE
QAVRGLEPGEARTGTGELVRIPVVYDGEDLPGVAELTGLPVREVVRLHTSTTWTVAFGGF
APGFGYLTGGPPELTVPRRAESRTRVPAGAVGLAGEFSGVYPRPSPGGWQLIGRTELELW
REDRTPPALLRPGVRVRFEEAGQP
Download sequence
Identical sequences A0A0S1UX15
WP_075987725.1.40734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]