SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S1XZG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S1XZG4
Domain Number 1 Region: 14-213
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 6.15e-64
Family Chemotaxis phosphatase CheZ 0.000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S1XZG4
Sequence length 214
Comment (tr|A0A0S1XZG4|A0A0S1XZG4_9BORD) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome; Reference proteome OX=1746199 OS=Bordetella sp. N. GN=ASB57_09730 OC=Alcaligenaceae; Bordetella.
Sequence
MESSDNTQADAPTAEPSDLIHRIASLTRMLRDSMKELGLDQAIKDAAEAIPDARDRLRYV
AQMTEQAANRVLNAIDGAQPVQEDLARNAKQLESRWDEWFDKPLEMPQARELVKDTRAFL
QGVPAQTQITQSKLMEIMMAQDFQDLTGQVIMRMMDVVGAIERELLQVLLDSVPTEKRDE
ANSLLNGPQVNPDGKADVVTSQDQVDDLLASLGF
Download sequence
Identical sequences A0A0S1XZG4
WP_057652050.1.39676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]