SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S2MWP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0S2MWP9
Domain Number - Region: 18-50
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.068
Family eIF-2-alpha, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S2MWP9
Sequence length 67
Comment (tr|A0A0S2MWP9|A0A0S2MWP9_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:ALO80356.1} KW=Complete proteome OX=1747285 OS=Cellulophaga phage phi4:1_18. GN=Phi4118_150 OC=Cba41virus.
Sequence
MKVYLSRYSNKDTYIKGFPDKKEVVVSMGEAVKLAREKIAETRGTTTFVGFKIHDLDENL
KHSLPSY
Download sequence
Identical sequences A0A0S2MW64 A0A0S2MWP9 A0A0S2MXC6 R9ZZI4 S0A5H8
YP_008240738.1.16771 YP_008241649.1.54216 gi|526176876|ref|YP_008240738.1| gi|526177821|ref|YP_008241649.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]