SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S2Z4L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S2Z4L9
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 3.54e-46
Family Nucleoside diphosphate kinase, NDK 0.00023
Further Details:      
 
Weak hits

Sequence:  A0A0S2Z4L9
Domain Number - Region: 157-194
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0105
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S2Z4L9
Sequence length 212
Comment (tr|A0A0S2Z4L9|A0A0S2Z4L9_HUMAN) Non-metastatic cells 5 protein expressed in isoform 1 {ECO:0000313|EMBL:ALQ33874.1} OX=9606 OS=Homo sapiens (Human). GN=NME5 OC=Catarrhini; Hominidae; Homo.
Sequence
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVE
KYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQK
PADPLIWLADWLLKNNPNKPKLCHHPIVEEPY
Download sequence
Identical sequences A0A0S2Z4L9 P56597
ENSP00000265191 9606.ENSP00000265191 NP_003542.1.87134 NP_003542.1.92137 ENSP00000265191 gi|4505413|ref|NP_003542.1| ENSP00000265191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]