SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S3FWE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S3FWE8
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily YdhG-like 1.12e-34
Family YdhG-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S3FWE8
Sequence length 121
Comment (tr|A0A0S3FWE8|A0A0S3FWE8_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:ALR32023.1} KW=Complete proteome; Reference proteome OX=1721091 OS=Chryseobacterium sp. IHB B 17019. GN=ATE47_16510 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKNSFKNIDEYMLLFPEIQEKLEELRKIIHAQNPEIEEYIGYQMPAFRYKNKPLVYFAGY
KKHIGFYPGPEGIKNFEKDFIQRKYKFSKGAVQFPVNEELPLDLIKQLVKFRLDDIDQKK
S
Download sequence
Identical sequences A0A0S3FWE8
WP_062162992.1.63094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]