SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S3IXD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S3IXD5
Domain Number 1 Region: 57-156
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.000000000000353
Family Inhibitor of apoptosis (IAP) repeat 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S3IXD5
Sequence length 241
Comment (tr|A0A0S3IXD5|A0A0S3IXD5_9ABAC) Inhibitor of apoptosis protein 2 {ECO:0000313|EMBL:ALR70525.1} OX=268591 OS=Anticarsia gemmatalis multiple nucleopolyhedrovirus. GN=AGNV_092 OC=Viruses; dsDNA viruses, no RNA stage; Baculoviridae; Alphabaculovirus.
Sequence
MDLKKFNFLILSTHGRVKTMTPLLLDNVQKMDLAKTGFFFHNNMLKCIGCRTTMDKIDAK
RVKRHTYSDYCISATNALLANESLRKQSFCSFKWARRQFASQPRVIDMLSRRGFYCFGKR
LRCAGCKAVVAYESVDAAQRGHDAVCAFRHVVDVNLDESTFKVLQADLSPPRLERVEPSA
PQADSSSSSIVSECKVCFSNEKSVCFLPCRHLAVCATCSPRCKKCCVCNGKITSRIETLP
Q
Download sequence
Identical sequences A0A0S3IXD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]