SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S3J2J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S3J2J0
Domain Number 1 Region: 33-129
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000196
Family Insect pheromone/odorant-binding proteins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S3J2J0
Sequence length 134
Comment (tr|A0A0S3J2J0|A0A0S3J2J0_9CUCU) Odorant binding protein 10 {ECO:0000313|EMBL:ALR72498.1} OX=561076 OS=Colaphellus bowringi. GN= OC=Chrysomelini; Colaphellus.
Sequence
MTGLKNLKNVFSACFLLLLANVLLISAEKKLPIEAEECLKITNTDLKDMMAHPKEMSESH
YCFFKCIFEKRGIINKVDGTVVPDVLDDIKDVAVLQVASEEKLAELKKCMADVEKIEKCT
DMENFRVCFDKLMS
Download sequence
Identical sequences A0A0S3J2J0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]