SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S3J433 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S3J433
Domain Number 1 Region: 52-151
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 6.8e-40
Family Chemosensory protein Csp2 0.0000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S3J433
Sequence length 162
Comment (tr|A0A0S3J433|A0A0S3J433_9CUCU) Chemosensory protein 12 {ECO:0000313|EMBL:ALR72526.1} OX=561076 OS=Colaphellus bowringi. GN= OC=Chrysomelini; Colaphellus.
Sequence
MKEGKARKLSQCYSFHGHEQCKYISLKMFLPFVVLSCLITLSISAVPEKSRYTTKYDNIN
LEEIIHNDRLLKNYVDCLLDKGRCTPDGLELKKNMPDAIETDCSKCSDKQKEGSEIMMRY
LIDNKPEYWNPLQEKYDPSGSYKKRYLDAKKTEVSVEPIVKS
Download sequence
Identical sequences A0A0S3J433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]