SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S3PC80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S3PC80
Domain Number 1 Region: 16-187
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.0000000000471
Family Hypothetical protein YwqG 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S3PC80
Sequence length 202
Comment (tr|A0A0S3PC80|A0A0S3PC80_9NOSO) Uncharacterized protein {ECO:0000313|EMBL:BAT53276.1} KW=Complete proteome; Reference proteome OX=1751286 OS=Nostoc sp. NIES-3756. GN=NOS3756_22350 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MALLIRESNQMSLHQLTKMGGKPLAPSNTQWGSCSVCGGWMQFIGQIDLEETAIKEVSKR
KQLLLIFMCTNNPGLCDEWNADLGGNAAILVSKTNLTSLEAPCDKEEFLLEETLLSLDQC
DDSAETYCQILNQSQNQVCGKIGGEPLWIQADETPICSCGARMRFVFQLEYSAEIQFGDA
GSGYGFICLVCQQRAKFLWQCC
Download sequence
Identical sequences A0A0S3PC80
WP_067768299.1.33109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]