SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S3TEE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S3TEE2
Domain Number 1 Region: 36-85
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000000209
Family DNA polymerase beta, N-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S3TEE2
Sequence length 117
Comment (tr|A0A0S3TEE2|A0A0S3TEE2_PHAAN) Uncharacterized protein {ECO:0000313|EMBL:BAU03497.1} OX=157739 OS=Vigna angularis var. angularis. GN=VIGAN_UM117900 OC=Phaseoleae; Vigna.
Sequence
MDKQTNSCAYISNLVTLPIGPQHLDSESDDCSYLSWSRCLKALGDDRRSFSYYKAIAVIE
KLPFKIESADQINNLPSIGKSLKDHELESAAAVVQVLKSDAAMLVQFPWSALYHSSW
Download sequence
Identical sequences A0A0S3TEE2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]