SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S4ILX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S4ILX8
Domain Number 1 Region: 81-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.31e-24
Family Nucleotide and nucleoside kinases 0.00021
Further Details:      
 
Domain Number 2 Region: 21-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000178
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S4ILX8
Sequence length 258
Comment (tr|A0A0S4ILX8|A0A0S4ILX8_BODSA) Adenylate kinase, putative {ECO:0000313|EMBL:CUF34312.1} KW=Complete proteome; Reference proteome OX=75058 OS=Bodo saltans (Flagellated protozoan). GN=BSAL_61600 OC=Eukaryota; Euglenozoa; Kinetoplastida; Bodonidae; Bodo.
Sequence
MSINSMSTADYRRNVERKKVSAEKYLAQHRIRWLLEQVTSELVLLTPNEPIEFMVKRIEQ
MYALADSNASTDDIAIQRPRLLCVLGGPASGKAVPCAFLTEDAGMSIIAPSELIREEIRL
GTEMGKEIGELLQRGETVPTAIITKLIQNHITDPKGSYVLDGYPRTLEQCLALESQVAEI
SLAIFLECSEDTMVARMAARQGGEDDHEPLRSEKLQYFQLRTIPVIEYLKAVGKLVAIDG
EANKAEAIRQVQTVLNQQ
Download sequence
Identical sequences A0A0S4ILX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]