SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S4JCS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S4JCS1
Domain Number 1 Region: 98-168
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000867
Family Polcalcin 0.076
Further Details:      
 
Domain Number 2 Region: 8-48
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000248
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S4JCS1
Sequence length 174
Comment (tr|A0A0S4JCS1|A0A0S4JCS1_BODSA) Ca2+-binding protein, putative {ECO:0000313|EMBL:CUG87818.1} KW=Complete proteome; Reference proteome OX=75058 OS=Bodo saltans (Flagellated protozoan). GN=BSAL_12165 OC=Eukaryota; Euglenozoa; Kinetoplastida; Bodonidae; Bodo.
Sequence
MNSMYAAEQINIPPELGTILKQYTKAVMRDRPQELYKFSANFFANLCGQTAPFDEQGQLL
SQQQNRGATTGSNGDMVTDVIPDAGNFESVNTGDDVTQERISQIFKKYDTNQNGRLERDE
VPALIEDLRRALGLSDDEGFSSEELLSMLDSDEDGTIDLLEFRQLFFQSDESGL
Download sequence
Identical sequences A0A0S4JCS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]