SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S4JKK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S4JKK3
Domain Number 1 Region: 365-535,1785-1913
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.57e-39
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 233-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-24
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 404-783
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.36e-24
Family Ankyrin repeat 0.00074
Further Details:      
 
Domain Number 4 Region: 1931-1982,2052-2226
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.05e-19
Family Ankyrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 1567-1595,1759-1823
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000432
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S4JKK3
Sequence length 3253
Comment (tr|A0A0S4JKK3|A0A0S4JKK3_BODSA) Ankyrin repeat protein, putative {ECO:0000313|EMBL:CUG89927.1} KW=Complete proteome; Reference proteome OX=75058 OS=Bodo saltans (Flagellated protozoan). GN=BSAL_24110 OC=Eukaryota; Euglenozoa; Kinetoplastida; Bodonidae; Bodo.
Sequence
MHHPAPSNSKPKMLPKRLGQPTPLDAPVLCLIRTANATGTNLVATLHTTLETSLSDLRIK
LHGIAAAARTRMPLESSADQNIPQATYLHSTPQVSKGTPVNYTSASDLDKVMTARLHAFD
LTAPFRFVRLGGARTIPRAREAKLRLVDVLPIIHPAGLPQDPLWQCSPPYGTVVVKPKVD
DSPVREAIVALFVAQGEFIDDMHSEKIIMERLLLQQQSYGRQTNVKQLSTVVHKWNANAK
DFLGRTPLHEYSFEGNYAAVKYLVSLPFVRIEERDQQGNTALHLAAQSGHIDCATALLDN
GAHILIMNHIKQTPLHIALYKRNDTLVDLLCRRLKQQGIPLKDLAPLTDLSGANPMKIFK
DLAPPIEELILNGNVEELRAMTRHYLFGSVTKLVQPRRCFNNDTLLHVAAQSGREEMVKF
LIDEVRWLSLVPSSAHDAFLDGSKRSPLHLAASKGHTNIVRRLIPVMAQLSATTDVTGCT
PLMLALQHGNVLTAQFIVENFEDVGVNCVSRRGLTALHFAAMVGAVDVATRLISQFGAQV
DAHHTSTVVAKRKMMTSSSRPTGDDRQELLRFLRLVRSKYSRGTSRRRLAPLPMYERTTR
VLHGPTPLWCALASLPKEGPAVASLLLVHGAGSTFIDDSYLTHLLKFSLASKQWDISGAL
VRLMGTTAPTEGAILAFVCAEIPRFGSDCVRWLIDRKVGTDSVFNALKQVTKIGDIKTVK
YLLDNGATLSNQSACELLATAVLHRHAACVEEYVRRGAPLTNVDEEKSPLLIAAKLGFET
AVRGFAFAPSVSTFDAVNALVVLLRTATSTRAQIRRSNASAPLIDSWNAMGCSLLKRVLL
TDAHVHPVELLHLSCAAGLFKVADLLVEKLAALPTDARVAIIRSTPSAALRPSVTITPKP
LPGKKKSTSDSAKKRKPLYKPQLSFERFLYTAPSATTLEHRRVFRDAFSYLAQHGMRDLI
ESLIVDIRLSPWRNGDLRGWNAVDYALECGHYDTVVALVGSGVIPLRRHVSTASSKCGLF
CAAASEAYARLKRSGDISSAATSLRTLLEVIAELGFVEVLNDILKQLCVTLRQSNLQQLP
WVLAVVRAAVQHHQIGVLKLLVQQFVPDLGSPLSDGGEELLLSAVVSNAPQSMIHLLLCH
RVPVHVPSPLSKSTQRLLKSKLRDGADGKTKLIAAAAAATLFAHDTLSKILVAAGAPTAV
SADVSQDLVTMSVYSTKCDLTGANENTLFATLENLFALGCALPPLSTMKLAAEKGFTRVT
RLLLVNVGIVDKLREDFEQCEEGVEESILYQLMVHGGTAADEILPHAIATVEPSQSNETD
ADDGATEPAGLAKLIEALKLACAKNPKSASTMLQRALLNGCIHTSIFLAMLGVGLTKMPS
FLAWENRSSMPEGGGSLSKALARVLISASSSKREDAERSSDPRELLRVAAKVNNVQLVRL
LLQANRVVDVVSEPLDVLVESAVSGAAQATLALGLREAEELSLSIAPSSTALVQAIICDT
LSGRHAKGLSYSLLLGNIRRTSSSHVPVSLWKALSDSHQPLLSAVLRSRTLRRCLIVQQL
AFTRITPITLAAALGDEQLLLDLVRAGASVTCQLSEMGLIGTSLGVQQNSCALFSSSGSK
KWRQSNVDDGLRLEKAVAPSCPPLLSAVIDNSTIIEAQCRVSPIIVATRLFAMAHFSKRT
SLVSRYISLLRTLIRRGALTRDVLHVVAIVVTRFQCWDLVTDVIEEGVRLSSVHESTDRF
FQVLKLDDVPLLLRPIVGTSRHVLHTACRYATRDIIILLARHCVRQDVEGCRDGVGRTPL
YYSLLNPSNIEALETLVALQVPATTLCDYTTRRTPLMIASRAGNAAAVANLLKFGHVDAT
DAYGNTALMFGATSGKQDVVELLLSGQADATTTNNRGLTATMLAAAAGLDHIALPMAQHF
SRLASFLTSTTSLLHCAAMGGCQRVVDYILRTYDSLGIFQEDSCGLTPVYLAYAFGRGAI
LRQMLSELQHRTESAALALDEKLLNCDSRLHRYGWLSQAMTMGEALAQETKKRAKFSLAP
FELICAPQSDRLRHRRSRLLWCAENRNVVGVRVLADLNVCDDCFAIHGAARRGSVDVIQL
LIALRMSDPNQRDRRGFLPIEHAILAGHKETASFLMQQMRITVDTIHDSIHQSGTSVLHM
IAMSGSHSLLGALVPMLLQQGAPADPKTSIRAATDSLAAEATLSALLAEDVEGRTPFEVA
VLFGSAATTLRIAQAIQQVSALAVKDVTITIPSSLFELKPCISPSVRAALYDFFDVEEVF
TQSIFAETFNGTRKRRYATGGDAGDRLLFGDIRMIGVATMKTDPFCASKLEQVYTVDRER
QVLKQLISAMYLPFRLKFRPEGLKGLTSPEQVDVLQRLCTSTLLGKYLSLPPKLHPVGTL
ELESVQKRSEVGVALQGTTVVERFMCTKNAMHSIDLHSAIVDFHFIECRKELARTQTLLQ
EIVKSLRELSHPLLKSLVLRIDWNGLRLEGGVSNNNKSTGDEGAIVDPTESKNQLAIAVS
SVRYLNNELLPELRLSLCGGAIHDLLLNVSAAELSTVDCTLDKYHSVTLRCYESLLDIPN
AAKTDLVTTQGDAASVPPLFEGRDIVIPFIASSGLPFGASKKASQLHNAALVGLVRRATD
PIEQIVKKDVVLLGVQRLRDSFIQTVHELLMSSAASAPSSPLRFKLEIEGVEMDELPLEL
LQQLLSDTIEALRTILGVRSSGSISDAKSKQKKYNGPSSWKYLTSAHLVAQSVANGVNAV
TVLFSNRRAHIVRRNASRLMLCFTPTVAPCRHEIEQCIRADTIEMELEKLKELIPQTVHD
MSQRLNTYLPTTSLVVDLPSLTDLPSDDDVLAALALLNHDRSAVILQELIRGISVGWDTK
LGSLVRRHVRTLTVTLQRSGSNATVSLLQNGNLVIHYPLQCVEYARGRPHNISTWAVPSS
QQIASLLLLQLSSLHPEVKTLVDLTKGYACWCNVTGAHTRRVIAGDVRCGFTITVRNVLN
LPPKDSLEETFEFVSDKSLSSLRVKRQPVTTATKAKCVTVYYVKFSAPTEGPFLNLAVKL
HGQHVLNSPLRIRVRPSSCSPSQTICTSAFNCVVAKEKSRLTFQLRDQFGSAVLATPSNL
QVDGPSINNPDRVMLASWASKVPGVVSVLFSVEKEGAEIPVPIRFQVGGESHVVVKTVEV
VSPDIYKAIIDIKKGSIEEANKNPNDDHSKKGQSKAKLYFRAAVRSSERAKKQRACRRVG
GVKHRKFPPSSDK
Download sequence
Identical sequences A0A0S4JKK3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]