SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S4T9B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S4T9B9
Domain Number 1 Region: 51-253
Classification Level Classification E-value
Superfamily ADP-ribosylation 8.92e-20
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 2-47
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.00000301
Family Domain of poly(ADP-ribose) polymerase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S4T9B9
Sequence length 259
Comment (tr|A0A0S4T9B9|A0A0S4T9B9_HYMMI) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=85433 OS=Hymenolepis microstoma (Rodent tapeworm) (Rodentolepis microstoma). GN= OC=Cyclophyllidea; Hymenolepididae; Hymenolepis.
Sequence
MPALLDNLEVIKSKLGMLEDLLKIEVAYSLMKTGNSDATPIDKHYEKVSNRIEPMDRESE
EIVRIAEYLRATHAPTHSTYTLDIVDIFALSKEGEAGKFKALDKRTFLWRGSRRTKIAGI
LQICLLSPLITVTLLLLLLVVVFCNVALGKVKECFSAKKSQLAKKFNSHKGNCKSGSLAL
IQTTDYNEVTWLVNLGVGATAYYKGPETGVVYPIGEAVTSADIKSDLLYNEYIPYDTAQI
QQRYLVWVDFKYKFYMSST
Download sequence
Identical sequences A0A0S4T9B9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]