SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S6UNI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S6UNI8
Domain Number 1 Region: 25-214
Classification Level Classification E-value
Superfamily VC0467-like 2.62e-61
Family VC0467-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S6UNI8
Sequence length 214
Comment (tr|A0A0S6UNI8|A0A0S6UNI8_9BRAD) UPF0301 protein BDOA9_0121920 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1126627 OS=Bradyrhizobium sp. DOA9. GN=BDOA9_0121920 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MAPTGKRTGESTRSSGAAPPSSGGYLDGRLLIAMPVMGDSRFERSVIYLCAHSAEGAMGI
IVNHPAGSIDFPELLQQLGIIKKGEHIKLPENAESMKVLRGGPVDTGRGFVLHSSDFYIE
NATLRIDDGVCLTATVDILRAIANGSGPKHAILALGYAGWAPGQLETEIQSNGWLHCDAD
ADLIFGDDVDDKYNRALQKIGIDPGMLSNEAGHA
Download sequence
Identical sequences A0A0S6UNI8
WP_025034002.1.83595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]