SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7FWP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7FWP8
Domain Number 1 Region: 123-254
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-34
Family cAMP-binding domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 251-316
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000223
Family cAMP-binding domain 0.00021
Further Details:      
 
Domain Number 3 Region: 2-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000353
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7FWP8
Sequence length 366
Comment (tr|A0A0S7FWP8|A0A0S7FWP8_9TELE) KAP3 {ECO:0000313|EMBL:JAO19650.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=KAP3 OC=Poeciliinae; Poeciliopsis.
Sequence
MSIEIPEGLTELLQSFTVEVLRNQPRDLLEFALQYFTRLKDSETKEASFGNDQNSAPRSG
KAVNFIDEAMQIDSENGEEEEDDDDDEEFIAPVINRFIRRASVCAEAFNPDEDDEDKEPR
VTHPKTDEQRQRLQEACRDILLFKNLDPEQISQVLDAMFEKFCTEGEHIIDQDDDGDNFY
VIESGTFNIFVKIEGAEKLVGSYDNKGSFGELALMYNTPRAATIIATSPGALWCLDRLTF
RRIIVKNNAKKRKMYEAFIETLPLLTSLEVSERMKVVDVLSTRVYNDSQQIIAQGDLADC
FYIVESGQVRITMKRSRTKKTRRRKRSSILPRARGASILGSWLLSQTSPELHRHMLWGVS
NVWSWM
Download sequence
Identical sequences A0A0S7FWP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]