SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7GRI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7GRI2
Domain Number 1 Region: 29-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000126
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 2 Region: 92-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000403
Family Fibronectin type I module 0.022
Further Details:      
 
Domain Number 3 Region: 194-239
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7GRI2
Sequence length 309
Comment (tr|A0A0S7GRI2|A0A0S7GRI2_9TELE) CTGF {ECO:0000313|EMBL:JAO29555.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=CTGF OC=Poeciliinae; Poeciliopsis.
Sequence
MSAGMKKTILLPVLCIMFSCMAEGQECSGQCSCPSTPPQCPPGVSLVLDGCGCCRVCAKQ
MSELCTEKDVCDPHKGLYCDFGAPTNRRIGVCTAREGATCVFGGMVYKNGESFQSSCKYQ
CTCLDGAVGCVPLCSMDIRLPSPDCPMPKRVKVPGKCCEEWICESPKKNSFAGTALAAYR
EEETYGPDPNTMRENCLVQTTEWSACSKTCGLGISTRVTNDNHQCRLEKQTRLCMVRPCE
SQLEQSIRKGKKCIRTPRVSKPMKFEISGCTTTKSYRPKFCGVCVDGRCCTPHRTTTLPM
EFKCPDRAR
Download sequence
Identical sequences A0A0S7GRI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]