SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7H6B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7H6B6
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000262
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0S7H6B6
Sequence length 111
Comment (tr|A0A0S7H6B6|A0A0S7H6B6_9TELE) TRPC1 {ECO:0000313|EMBL:JAO36710.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=TRPC1 OC=Poeciliinae; Poeciliopsis.
Sequence
MHISAWPYSLSVVMAALYQGTDTSSPDKFLALKDVREVKEETTLDEKLFLLACEKGDYYM
VKKLLEENCHGELNVNCADVLGRDAVTITIENENLDILQLLLEHGCQVCQK
Download sequence
Identical sequences A0A0S7H6B6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]