SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7I2G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7I2G4
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily GAT-like domain 3.92e-31
Family GAT domain 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7I2G4
Sequence length 196
Comment (tr|A0A0S7I2G4|A0A0S7I2G4_9TELE) TM1L2 {ECO:0000313|EMBL:JAO47360.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=TM1L2 OC=Poeciliinae; Poeciliopsis.
Sequence
TKAAPQPIPPAYSAPQAPSLQPGGAVTPSPEQISRLRSELDVVRGNTKVMSEMLTEMVPG
QEDTSDYELLQELNRTCRAMQQRIVELISCVSNEAVTEELLHANDDLNNIFLRYDRYERF
RSGRSSAQSVNNGVLSEATEDNLIDLGPGSPAVVSNMPSAAPSSLPPPEHRCREALVPSL
PGLPPGRFRRGCRQCQ
Download sequence
Identical sequences A0A0S7I2G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]