SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7I9G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7I9G3
Domain Number 1 Region: 6-45
Classification Level Classification E-value
Superfamily CCHHC domain 0.0000000000000602
Family CCHHC domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0S7I9G3
Sequence length 127
Comment (tr|A0A0S7I9G3|A0A0S7I9G3_9TELE) MYT1L {ECO:0000313|EMBL:JAO49784.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=MYT1L OC=Poeciliinae; Poeciliopsis.
Sequence
MYENVLKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCNGPKSNQASD
RVLSTPRSNLAKELEKYSKTSFDYSAFDGSNNHQVYGKRAIAPKVHGHRDTSPKGYDAKR
YCKNSSS
Download sequence
Identical sequences A0A0S7I9G3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]