SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7ISQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7ISQ8
Domain Number 1 Region: 27-87
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000119
Family ATI-like 0.015
Further Details:      
 
Domain Number 2 Region: 142-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000315
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7ISQ8
Sequence length 251
Comment (tr|A0A0S7ISQ8|A0A0S7ISQ8_9TELE) ZAN {ECO:0000313|EMBL:JAO55171.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=ZAN OC=Poeciliinae; Poeciliopsis.
Sequence
CGSYEAYATACQEAGVRLGAWRQNLNCALACGANSSYSQCMTACPSSCADLAAPSECDVT
SCVEGCQCASGFVMSEGICVPYPQCGCTFLSRYYPLNEKFVTEDCSQSCECTSRGAVCQP
KSCQEGYLCTIFELKRDCFKASPCLSSPCENGGTCVAGNNNTFVCECPEGFEGDVCEMEV
TEVPGGLATKWIILIAVLASAVFVVIVITIVCVCTRKNKNSISDDGSVSLKSTGYSYEQM
DDERKEKLTNM
Download sequence
Identical sequences A0A0S7ISQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]