SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0S7IVD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0S7IVD2
Domain Number 1 Region: 10-180
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 6.01e-74
Family Crystallins/Ca-binding development proteins 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0S7IVD2
Sequence length 184
Comment (tr|A0A0S7IVD2|A0A0S7IVD2_9TELE) CRGM2 {ECO:0000313|EMBL:JAO56945.1} OX=188132 OS=Poeciliopsis prolifica (blackstripe livebearer). GN=CRGM2 OC=Poeciliinae; Poeciliopsis.
Sequence
ISLASTKTSMGKIIFYEDRNFQGRHHECMSDCADLHPYFNRCNSIRVESGCFMVYDRPHY
LGHQYFLRRGEYSDNQRLIGINDCIRSCRMIPMHRGSYKIRLYERPDMAGQMQEISDDCP
NVQDRLRMSDINSCNVVDGHWLLYDQPNYRGRTYYLRPGEYRRYSDWGGASPKIGSLRRI
TDFN
Download sequence
Identical sequences A0A0S7IVD2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]